SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003023 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003023
Domain Number 1 Region: 37-230
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.62e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000948
Further Details:      
 
Domain Number 2 Region: 487-673
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-45
Family Ankyrin repeat 0.0000271
Further Details:      
 
Domain Number 3 Region: 226-358
Classification Level Classification E-value
Superfamily E set domains 6.07e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000185
Further Details:      
 
Domain Number 4 Region: 737-816
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000942
Family DEATH domain, DD 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003023   Gene: ENSPPYG00000002599   Transcript: ENSPPYT00000003127
Sequence length 868
Comment pep:known chromosome:PPYG2:10:101447592:101454599:1 gene:ENSPPYG00000002599 transcript:ENSPPYT00000003127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESCYNPGLDGIIEYDDFKLNSSIVEHKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGIC
AVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQLLRSRPQGLTEAEQRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEA
AEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHL
LTAQDENGDTPLHLAIIHGQTSVIEQIAYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQT
SVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEG
LYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKKGGA
DIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQN
TMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTAS
PSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQS
VEQEAEKLGPPPEPPGGLCHGHPQPQVH
Download sequence
Identical sequences H2NBF1
9600.ENSPPYP00000003023 ENSPPYP00000003023 ENSPPYP00000003023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]