SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003077 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003077
Domain Number 1 Region: 10-85
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000523
Family HLH, helix-loop-helix DNA-binding domain 0.0000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003077   Gene: ENSPPYG00000002642   Transcript: ENSPPYT00000003181
Sequence length 169
Comment pep:novel chromosome:PPYG2:10:109569217:109610840:1 gene:ENSPPYG00000002642 transcript:ENSPPYT00000003181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFFFFFFSFRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKL
EEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEV
DVESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVKLSFTS
Download sequence
Identical sequences H2NBK2
ENSPPYP00000003077 ENSPPYP00000003077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]