SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003356 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003356
Domain Number 1 Region: 51-297
Classification Level Classification E-value
Superfamily L domain-like 1.31e-35
Family Ngr ectodomain-like 0.025
Further Details:      
 
Domain Number 2 Region: 782-823
Classification Level Classification E-value
Superfamily DEATH domain 0.0000386
Family DEATH domain, DD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003356   Gene: ENSPPYG00000002884   Transcript: ENSPPYT00000003471
Sequence length 825
Comment pep:known chromosome:PPYG2:11:592004:597056:-1 gene:ENSPPYG00000002884 transcript:ENSPPYT00000003471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPRGCQQLLHLCVQQPLQ
LLQVEFLRLSTHEDPQLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACLRGALTNLPAG
LSGLAHLAHLDLSFNSLETLPACVLRMRGLGALLLSHNCLSELPEALGAIPALTFLAVTH
NRLQTLPPALGALSTLQRLDLSQNLLDTLPPEIGGLGSLLELNLASNRLQSLPASLAGLR
SLRLLVLHSNLLASVPAGLARLPFLTRLDLRDNQLRDVPPELLDAPFVRLQGNPLGEASP
GAPSSPVAALIPEMPRLFLTSDLDSFPVTPRGCSVTLACGVRLQFPAGATATPITIHYRL
LLPEPGLVPLGPHDALLSHVLELQPHGVAFQQDVGLWLLFTPPRARRCREVVVRTRNDNS
WGDLETYLEEEAPQRLWAHCQAPHFSWFLVVSRPVSNACLVPPEGTLLCSSGHPGVKVIF
PPGATEEPRRVSMQVVRMAGRELQALLGEPEAAVSPLLCLSQNGPPSFLRPVTVQLPLPS
GITGLSLDRSRLHLLYWAPPAATWDDITAQVGLELTHLYARFQVTHFSWYWLWYTTKNCV
GGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTV
EMFEGEEFFAAFERGIDVDADRPDCVEGRICFVFYSHLKNVKEVYVTTALDREAQAVRGQ
VSFYRGAVPVQVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGAGLSLAPLNLG
DAETGFLTQSNLLSVAGRLGPDWPAVALHLGVSYRELQRIRHECR
Download sequence
Identical sequences H2NCC3
ENSPPYP00000003356 XP_002821379.1.23681 ENSPPYP00000003356 9600.ENSPPYP00000003356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]