SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000003399 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000003399
Domain Number 1 Region: 54-130
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.5e-18
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000003399   Gene: ENSPPYG00000002926   Transcript: ENSPPYT00000003519
Sequence length 193
Comment pep:known chromosome:PPYG2:11:3555338:3555919:-1 gene:ENSPPYG00000002926 transcript:ENSPPYT00000003519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGGALPRSAPPAPRVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERER
NRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL
RPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAE
RELLDFSSWLGGY
Download sequence
Identical sequences A0A2I3SUX4 G3QWU2 H2NCG5
ENSPPYP00000003399 ENSPPYP00000003399 XP_002821424.1.23681 XP_004050485.1.27298 XP_521719.2.37143 ENSPTRP00000048307 9598.ENSPTRP00000048307 9600.ENSPPYP00000003399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]