SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004344 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004344
Domain Number 1 Region: 275-452
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00000125
Further Details:      
 
Domain Number 2 Region: 2-163
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-40
Family BAR domain 0.0063
Further Details:      
 
Domain Number 3 Region: 135-244
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000117
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 597-652
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000394
Family SH3-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004344   Gene: ENSPPYG00000003799   Transcript: ENSPPYT00000004519
Sequence length 653
Comment pep:known chromosome:PPYG2:11:97207446:97289726:1 gene:ENSPPYG00000003799 transcript:ENSPPYT00000004519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGKKKFDKESEKYYSILEKHLNLSAKKKESHLQEADTQIDREHQNFYEASLEYVFKIQEV
QEKKKFEFVEPLLSFLQGLFTFYHEGYELAQEFAPYKQQLQFNLQNTRNNFESTRQEVER
LMQRMKSANQDYRPPSQWTMEGYLYVQEKTLGPLGFTWIKHYCTYDKGSKTFTMSVSEMK
SSGKMNGLVTSSPEMFKLKSCIRRKTDSIDKRFCFDIEVVERHGIITLQAFSEANRKLWL
EAMDGKEPIYTLPAIISKKEESKSFLYLNEAGFNFVRKCIQAVETRGITILGLYRIGGVN
SKVQKLMNTTFSPKSPPDIDIDIELWDNKTITSGLKNYLRCLAEPLMTYKLHKDFIIAVK
SDDQNYRVEAVHALVHKLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTLMR
AQEETVAAMMNIKFQNIVVEILIEHYEKIFHTAPDPSIPLPQPQSRSGSRRTRAICLSTG
SRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSHSSEQNSTTKSASCQPREKSGGI
PWIATPSSSNGQKSLGLWTTSPESSSKETPKASPNPDLPPKMCRRLRLDTASSNGSFSQA
KAMYSCKAEHSHELSFPQGAIFSNVYPSVEPGWLKATYEGKTGLVPENYVVFL
Download sequence
Identical sequences H2NF16
ENSPPYP00000004344 ENSPPYP00000004344 9600.ENSPPYP00000004344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]