SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004540 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004540
Domain Number 1 Region: 48-176
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 2.62e-58
Family N-terminal domain of cbl (N-cbl) 0.000000168
Further Details:      
 
Domain Number 2 Region: 263-349
Classification Level Classification E-value
Superfamily SH2 domain 2.09e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 355-433
Classification Level Classification E-value
Superfamily RING/U-box 8.17e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 
Domain Number 4 Region: 177-262
Classification Level Classification E-value
Superfamily EF-hand 2.14e-38
Family EF-hand modules in multidomain proteins 0.00000543
Further Details:      
 
Domain Number 5 Region: 842-892
Classification Level Classification E-value
Superfamily UBA-like 0.00000689
Family UBA domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004540   Gene: ENSPPYG00000003962   Transcript: ENSPPYT00000004718
Sequence length 905
Comment pep:known chromosome:PPYG2:11:116154080:116249493:1 gene:ENSPPYG00000003962 transcript:ENSPPYT00000004718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHLSPHPPGTVDKKMVEKCWK
LMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMEN
LMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRI
TKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEF
DIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLG
QWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHI
KVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRC
EIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVERP
PSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLRD
LPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPVS
APSSSDAWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSVNSSPLVGPECDH
PKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRACD
CDQQIDSCTYEAMYNIQSQAPSVTESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPPV
PAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSCQ
QGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSP
AHVAT
Download sequence
Identical sequences H2NFK5
ENSPPYP00000004540 9600.ENSPPYP00000004540 ENSPPYP00000004540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]