SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000004933 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000004933
Domain Number 1 Region: 810-1000
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.07e-63
Family Adenylyl and guanylyl cyclase catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 44-424
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.05e-55
Family L-arabinose binding protein-like 0.00075
Further Details:      
 
Domain Number 3 Region: 506-774
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.41e-45
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000004933   Gene: ENSPPYG00000004320   Transcript: ENSPPYT00000005127
Sequence length 1073
Comment pep:known chromosome:PPYG2:12:15092220:15175731:-1 gene:ENSPPYG00000004320 transcript:ENSPPYT00000005127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTLLLDLALWSLLFQAGGLSWSSQVSQNCHNGSYEISVLMMDNSAFAEPLENLEDAVNE
GLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAKRMGCVLI
GPSCTYSTFQMYLDTELSYPMISAGSFGLSCDYKETLTRLMSPARKLTYFLVNFWKTNDL
PFKTYSWSTSYVYKNGTETEDCFWYLNALEAGVSYFSHELSFKAVLRQDKEFQDILTDHN
RKSNVIIMCGGPEFLYKLKGDRAVAEDIVIILVDLFNDQYFEGNVTAPDYMKNVLVLTLS
PGNSLLNSSFSRNLSPTKRDFALAYLNGILLFGHMLMIFLENGENITTPKFAHAFRNLTF
EGYDGPVTLDDWGDVDSTMMLLYTSVDTKKYKVLLTYDTHVNQTNPVDMSPTFTWKNSKL
PNDITGRGPQILMIAVFTLTGAVVLLLLVALLMLRKYKKDYELRQKKWSHIPPENIFPLE
TNETNHVSLKIDDDKRRDTIQRLRQCKYDKKRVILKDLKHNDGNFTEKQKIELNKLLQID
YYNLTKFYGTVKLDTMIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIAKG
MSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDLWTAPEHLRQANISQK
GDVYSYGIIAQEIILRKETFYTLSCRDRNEKIFRVENSNGMKPFRPDLFLETAEEKELEV
YLLVKNCWEEDPEKRPDFKKIETTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVE
ERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGFVEPELYEEVTIYFSDIVGFTTICKYS
TPMEVVDMLNDIYKSFDHIVDHHDVYKVETIGDAYMVASGLPKRNGNRHAIDIAKMALEI
LSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPL
RIHVSGSTIAILKRTECQFLYEVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQ
RLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTDKESTYF
Download sequence
Identical sequences H2NGP2
ENSPPYP00000004933 XP_002823018.1.23681 9600.ENSPPYP00000004933 ENSPPYP00000004933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]