SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005076 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005076
Domain Number 1 Region: 183-481
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.17e-91
Family Nuclear receptor ligand-binding domain 0.000000000709
Further Details:      
 
Domain Number 2 Region: 80-168
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-28
Family Nuclear receptor 0.00000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005076   Gene: ENSPPYG00000004448   Transcript: ENSPPYT00000005276
Sequence length 486
Comment pep:known chromosome:PPYG2:12:47478988:47548587:-1 gene:ENSPPYG00000004448 transcript:ENSPPYT00000005276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVLGCLCLSKGGSRAVCAGSAEQLVHPPAGPEAFGSEVSVRPHRRAPLGSTYLPPAPSGM
EAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCP
FNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLR
PKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGD
SSSSCSDNCITSPDMMALSSFSNLDLSEEDSYDPSVTLELSQLSMLPHLADLVSYSIQKV
IGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRISDVT
KAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSN
TLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEV
FGNEIS
Download sequence
Identical sequences H2NH30
ENSPPYP00000005076 ENSPPYP00000005076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]