SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005112 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005112
Domain Number 1 Region: 5125-5283
Classification Level Classification E-value
Superfamily SET domain 9.03e-49
Family Histone lysine methyltransferases 0.0065
Further Details:      
 
Domain Number 2 Region: 1145-1205
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000487
Family PHD domain 0.0039
Further Details:      
 
Domain Number 3 Region: 267-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000642
Family PHD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1220-1289
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000115
Family PHD domain 0.025
Further Details:      
 
Domain Number 5 Region: 1099-1153
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000113
Family PHD domain 0.017
Further Details:      
 
Domain Number 6 Region: 224-277
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000946
Family PHD domain 0.01
Further Details:      
 
Domain Number 7 Region: 1750-1800
Classification Level Classification E-value
Superfamily HMG-box 0.00000209
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005112   Gene: ENSPPYG00000004478   Transcript: ENSPPYT00000005313
Sequence length 5283
Comment pep:known chromosome:PPYG2:12:48681670:48716139:-1 gene:ENSPPYG00000004478 transcript:ENSPPYT00000005313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQKLAGEDKDSEPAADGPAASEDPSVTESDLPNPHVGEVSVLSSGSPRLQESPQDCSG
GPVRRCALCNCGEPSLHGQRELRRFELPFDWPRCPVVSPGGSPGPNEAVLPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRLGA
SIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAHLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRACGVGSAELNPNSEWFENYSLCHRCHKAQGGQPISS
VAEQHTPVCSRFSPPEPGDTPTDEPDALYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLG
RAGVQLEPQLEAPLNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPPEESPASPLP
EALHLSRPPEESPLSPPPEESPLSPQPESSPFSPLEESPFSPPEESPPSPALETPLSPPP
EASPLSPPFEESPLSPPPEELPTSPPPEASRLSPPPEESPMSPPPEESPMSPPPEASRLF
PPFEESPLSPPPEESPLSPPPEASRLSPPPEDSPMSPPPEESPMSPPPEVSRLSPLPVVS
RLSPPPEESPLSPPALSPLGELEYPFGAKGDSDPESPLAAPILETPISPPPEANCTDPEP
VPPMILPPSPGSPMGPASPILMEPLPPQCSPLLQHSLASQNSPPSQCSPPALPLSVPSPL
SPIGKVVGVSDEAELHEMETEKVSEPECPALEPSATSPLPSPMGDLSCPAPSPAPALDDF
SGLGEDTAPLDGIDAPGSQPEAGQTPGSLASELKGSPVLLDPEELAPVTPMEVYPECKQT
AGQGSPCEEQEEPRAPVAPTPPTLIKSDIVNEISNLSQGDASASFPGSEPLLGSPDPEGG
GSLSMELGVSTDVSPARDEGSLRLCTDSLPETDDSLLCDAGTAISGGKAEGEKGRRRSSP
ARSRIKQGRSSSFPGRRRPRGGAHGGRGRGRARLKSTASSIETLVVADIDSSPSKEEEEE
DDDTMQNTVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITK
VMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCV
SCMQCGAASPGFHCEWQNSYTHCGPCASLVTCPICHAPYVEEDLLIQCRHCERWMHAGCE
SLFTEDDVEQAADEGFDCVSCQPYVVKPVAPIAPPELVPMKVKEPEPQYFRFEGVWLTET
GMALLRNLTMSPLHKRRQRRGRLGLPGEAGLEGSEPSDALGPDDKKDGDLDTDELLKGEG
GVEHMECEIKLEGPVSPDVEPGKEETEESKKRKRKPYRPGIGGFMVRQRKSHTRTKKGPA
AQAEVLSGDGQPDEGETVIPADLPAEGAVEQSLAEGDEKKKQQRRGRKKSKLEDMFPAYL
QEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGSSERKELPTSQKGDDGPDIADE
ESRGLEGKADTPGPEDGGVKASPVPSDPEKPGTPGEGMLSSDLDRISTEELPKMESKDLQ
QLFKDVLGSEREQHLGCGTPGLEGSRTPLQRPFLQGGLPLGNLPSSSPMDSYPGLCQSPF
LDSRERGGFFSPEPGEPDSPWTGSGGTTPSTPTTPTTEGEGDGLSYNQRSLQRWEKDEEL
GQLSTISPVLYANINFPNLKQDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAAHR
INKVQKQAESQINKQTKVGDIARKTDRPALHLRIPPQPGALGSPPPAAAPTIFIGSPTTP
AGLSTSADGFLKPPAGSVPGPDSPGELFLKLPPQVPAQVPSQDPFGLAPAYPLEPRFPTA
PPTYPPYPSPTGAPVQPPMLGTSSRPGTGQPGEFHTTPPGTPRHQPSTPDPFLKPRCPSL
DNLAVPESPGVGGGKASEPLLSPPPFGESRKALEVKKEELGASSPSYGPPNLGFVDSPSS
GPHLGGLELKTPDVFKAPLTPRASQVEPQSPGLGLRPQEPPPAQALAPSPPSHPDIFRPG
SYPDPYAQPPLTPRPQPPPPESCCALPPRSLPSDPFSRVPASPQSQSSSQSPLTPRPLSA
EAFCPSPVTPRFQSPDPYSRPPSRPQSRDPFAPLHKPPRPQPPEVAFKAGSLAHTSLGAG
GFPAALPSGPAGELHAKVPSGQPPNFVRSPGTGAFVGTPSPMRFTFPQAVGEPSLKPPVP
QPGLPPPHGINSHFGPGPTLGKPQSTNYTVATGNFHPSGSPLGPSSGSTGESYGLSPLRP
PSVLPPPAPDGSLPYLSHGASQRSGITSPVEKREDPGAGMGSSLATAELPGTQDPGMSGL
SQTELEKQRQRQRLRELLIRQQIQRNTLRQEKETAAAAAGAVGPPGSWGAEPSSPAFEQL
SRGQTPFAGTQDKSSLVGLPPSKLSGPILGPGSFPSDDRLSRPPPPATPSSMDVNSRQLV
GGSQAFYQRAPYPGSLPLQQQQQQLWQQQQATAATSMRFAMSARFPSTPGPELGRQALGS
PLAGIPTRLPGPGEPVPGPAGPAQFIELRHNVQKGLGPGGTPFPGQGPPQRPRFYPVSED
PHRLAPEGLRGLAVSGLPPQKPSAPPAPELNNSLHPTPHTKGPTLPTGLELVNRPPSSTE
LGRPTPLALEAGKLPCEDPELDDDFDAHKALEDDEELAHLGLGVDVAKGDDELGTLENLE
TNDPHLDDLLNGDEFDLLAYTDPELDTGDKKDIFNEHLRLVESANEKAEREALLRGVEPG
PLGPEERPPPAADASEPRLASVLPEVKPKVEEGGRHPSPCQFTIATPKVEPTPAANSLGL
GLKPGQSMMGSRDTRMGTGPFSSSGHTAEKASFGATGGPPAHLLTPSPLSGPGGSSLLEK
FELESGALTLPGGPAASGDELDKMESSLVASELPLLIEDLLEHEKKELQKKQQLSAQLQP
AQQQPQQQQQHSLLSAPGPAQAMSLPHEGSSPSLAGSQQQLSLGLAGARQPGLPQPLMPT
QPPAHALQQRLAPSMAMVSNQGHMLSGQHGGQAGLVPQQSSQPVLSQKPMGTMPPSMCMK
PQQLAMQQQLANSFFPDTDLDKFAAEDIIDPIAKAKMVALKGIKKVMAQGSIGVAPGMNR
QQVSLLAQRLSGGPGSDLQNHVAAGSGQERSAGDPSQPRPNPPTFAQGVINEADQRQYEE
WLFHTQQLLQMQLKVLEEQIGVHRKSRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQS
KIQKQLDQVRKQQKEHTNLMAEYRNKQQQQQQQQQQQQQQQQHSAVLALSPSQSPRLLTK
LPGQLLPGHGLQPPQGPPGGQAGGLRLPPGGMALPGQPGGPFLNTALAQQQQQQHSGGAG
SLAGPSGGFFPGNLALRSLGPDSRLLQERQLQLQQQRMQLAQKLQQQQQQQQQHLLGQVA
VQQQQQQGPGVQTNQALGPKPQGLLPPGSHQGLLVQQLSPQPPQGPQGMLGPTQVAVLQQ
QHPGALGPQGPHRQVLMTQSRVLSSPQLAQQGQGLMGHRLVTAQQQQQQQQQHQQQGSMA
GLSHLQQSLMSHSGQPKLSAQPMGSLQQLQQQQQLQQQQQLQQQQQQQLQQQQQQQQLQQ
QQQQLQQQQQQQQQLQQQQQQLQQQQQQQLQQQQQQLQQQQQQLQQQQQQQQFQQQQQQQ
QMGLLNQSRTLLSPQQQQQQQVALGPGMPAKPLQHFSSPGALGPTLLLTGKEQNTVDPAV
SSEATEGPSTHQGGPLAIGTTPESMATEPGEVKPPLSGDSQLLLVQPQPQPQPSSLQLQP
PLRLPGQQQQQVSLLHTAGGGSHGQLGTGSSSEASSMPHLLAQPSVSLGDQPGPMTQNLL
GPQQPMLERPMQNNTGPQPPKPGPVLQSGQGLPGVGIMPTVGQLRAQLQGVLAKNPQLRH
LSPQQQQQLQALLMQRQLQQSQAVRQTPPYQEPGTQTSPLQGLLGCQPQLGGFPGPQTGP
LQELGAGPRPQGPPRLPAPPGALSTGPVLGPVHPTPPPSSPQEPKRPSQLPSPSSQLPTE
AQLPPTHPGTPKPQGPTLELPPGRVSPAAAQLADTLFSKGLGPWDPPDNLAETQKPEQSS
LVPGHLDQVNGQVVPEASQLSIKQEPREEPCALGAQSVKREANGEPIGVPGTSNHLLLAG
PRSEAGHLLLQKLLRAKNVQLSTGRGSEGLRAEINGHIDSKLAGLEQKLQGTPSNKEDAA
ARKPLTPKPKRVQKASDRLVSSRKKLRKEDGVRASEALLKQLKQELSLLPLTEPAITANF
SLFAPFGSGCPVNGQSQLRGAFGSGALPTGPDYYSQLLTKNNLSNPPTPPSSLPPTPPPS
VQQKMVNGVTPSEELGEHPKDAASARDTERALRDTSEVKSLDLLAALPTPPHNQTEDVRM
ESDDSDSPDSIVPASSPESILGEEAPRFPHLGSGQWEQEDRALSPVIPLIPRASIPVFPD
TKPYGALDLEVPGKLPATTWEKGKGSEVSVMLTVSAAAAKNLNGVMVAVAELLSMKIPNS
YEVLFPESPARAGTEPKKGEAEGPGGKEKGLGGKSPDTGPDWLKQFDAVLPGYTLKSQLD
ILSLLKQESPAPEPPTQHSYTYNVSNLDVRQLSAPPPEEPSPPPSPLAPSPASPPTEPLV
ELPAEPLAEPPVPSPLPLASSPESARPKPRARPPEEGEDSRPPRLKKWKGVRWKRLRLLL
TIQKGSGRQEDEREVAEFMEQLGTALRPDKVPRDMRRCCFCHEEGDGATDGPARLLNLDL
DLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYH
FACAIRAKCMFFKDKTMLCPMHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGER
LHMFRVGGLVFHAIGQLLPHQMADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSIGE
NNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELF
GLTVHAVLRIAESLPGVESCQNYLFRYGRHPLMELPLMINPTGCARSEPKILTHYKRPHT
LNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAA
KDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYIN
HSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAWNCRK
WMN
Download sequence
Identical sequences H2NH64
9600.ENSPPYP00000005112 ENSPPYP00000005112 ENSPPYP00000005112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]