SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005543 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005543
Domain Number 1 Region: 605-911
Classification Level Classification E-value
Superfamily WD40 repeat-like 3e-73
Family WD40-repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 962-1237
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.47e-53
Family WD40-repeat 0.00061
Further Details:      
 
Domain Number 3 Region: 107-367
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.28e-45
Family Extended AAA-ATPase domain 0.034
Further Details:      
 
Domain Number 4 Region: 1-92
Classification Level Classification E-value
Superfamily DEATH domain 1.32e-23
Family Caspase recruitment domain, CARD 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005543   Gene: ENSPPYG00000004860   Transcript: ENSPPYT00000005757
Sequence length 1248
Comment pep:known chromosome:PPYG2:12:99905452:99996639:1 gene:ENSPPYG00000004860 transcript:ENSPPYT00000005757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYISFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQSHTLSPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINK
KNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGS
SDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDVTSANERKS
INVKQFFLNSEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHH
STIQYCDFSPQNHLAVVALSQYCVELWNIDSRSKVADCRGHLSWVHGVMFSPDGSSFLTS
SDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIKRLQLINGKTGQIDYLT
EAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLIS
SSDDSEIQVWNWQLDKYIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNTEKD
FVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDHLLPLHELRGHNGCVRCSAFSVDST
LLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIK
WWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
Download sequence
Identical sequences H2NIC5
ENSPPYP00000005543 9600.ENSPPYP00000005543 XP_002823669.1.23681 XP_009246408.1.23681 XP_009246409.1.23681 XP_009246410.1.23681 ENSPPYP00000005543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]