SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000005872 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000005872
Domain Number 1 Region: 483-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 18-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-25
Family KRAB domain (Kruppel-associated box) 0.00081
Further Details:      
 
Domain Number 4 Region: 651-708
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.47e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 595-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 9 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 693-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 11 Region: 219-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000407
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000005872
Domain Number - Region: 189-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000421
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000005872   Gene: ENSPPYG00000005152   Transcript: ENSPPYT00000006099
Sequence length 754
Comment pep:known chromosome:PPYG2:12:136158614:136175971:1 gene:ENSPPYG00000005152 transcript:ENSPPYT00000006099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSRTDLSLADHLVQQQKMTMLQESFSFDDLSVDFTQKEWQLLDPSQKNLYKDVMLENYSS
LVSLGYEVMKPDVIFKLEQGEEPWVGDGEIPSSDSPVWKVDGNMMWHQDNQDKLKIIKRG
HECDAFGKNFNLNMNFVPLRKSNNEGDLDGLILKHHLDLLIPKGDYGKAESDDFNVFDNF
FLHSKPEDTDTWLKYYDCDKYKESYKKSQIIIYHRNRLGEKLYECSECRKRFSKKPSLIK
HQSRHIRDIAFGCGNCGKTFPQKSQFITHHRTHTGEKPYNCSQCGKAFSQKSQLTSHQRT
HTGEKPYECGECGKAFSRKSHLISHWRTHTGEKPYGCNECGRAFSEKSNLINHQRIHTGE
KPFECRECGKAFSRKSQLVTHHRTHTGTKPFGCSDCRKAFFEKSELIRHQTIHTGEKPYE
CSECRKAFRERSSLINHQRTHTGEKPHGCIQCGKAFSQKSHLISHQMTHTGEKPFICSKC
GKAFSRKSQLVRHQRTHTGEKPYECSECGKAFSEKLSLTNHQRIHTGEKPYVCSECGKAF
CQKSHLISHQRTHTGEKPYECSECGKAFGEKSSLATHQRTHTGEKPYECRDCEKAFSQKS
QLNTHQRIHTGEKPYECSLCRKAFFEKSELIRHLRTHTGEKPYECNECRKAFREKSSLIN
HQRIHTGEKPFECSECGKAFSRKSHLIPHQRTHTGEKPYGCSECRKAFSQKSQLVNHQRI
HTGEKPYQCIECGKAFSQKSQLINHQRTHKVKKS
Download sequence
Identical sequences H2NJ84
ENSPPYP00000005872 ENSPPYP00000005872 9600.ENSPPYP00000005872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]