SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000006796 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000006796
Domain Number 1 Region: 44-146,270-387
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.92e-36
Family FAD-linked reductases, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000006796   Gene: ENSPPYG00000005978   Transcript: ENSPPYT00000007064
Sequence length 393
Comment pep:known chromosome:PPYG2:14:75121115:75130223:1 gene:ENSPPYG00000005978 transcript:ENSPPYT00000007064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFTFMTRKSCYSKQVQRKYWRNCQKLTATGSAPFPLALQRFSVVWDACSEALIMFDKDN
LDDMGYIVENDVIMHALTKQLEAVSDRVTVLYRSKAIRYTWPCPFPMADSSPWVHITLGD
GSTFQPKLLIGADGHNSGVRQAAGIQNVSWNYDQSAVVATLHLSEATENNVAWQRFLPSG
PIALLPLSDTLSSLVWSTSHEHAAELVSMDEEKFVDAVNSAFWSDAAHTDFINTAGAMLQ
YAVGLLQPTKVSVRQLPPSVARVDAKSRVLFPLGLGHAAEYVRPRVALIGDAAHRVHPLA
GQGVNMGFGDISSLAHHLSTAAFNGKDLGSMSHLTGYETERQRHNTALLAATDLLKRLYS
TSASPLVLLRTWGLQATNAVSPLKEQIMAFASK
Download sequence
Identical sequences H2NLR6
9600.ENSPPYP00000006796 ENSPPYP00000006796 ENSPPYP00000006796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]