SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007036 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007036
Domain Number 1 Region: 96-392
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-90
Family Protein kinases, catalytic subunit 0.000000000135
Further Details:      
 
Domain Number 2 Region: 1-96
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-19
Family Pleckstrin-homology domain (PH domain) 0.0000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007036   Gene: ENSPPYG00000006192   Transcript: ENSPPYT00000007316
Sequence length 413
Comment pep:known chromosome:PPYG2:14:106542181:106568784:-1 gene:ENSPPYG00000006192 transcript:ENSPPYT00000007316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEKVILVKEKATGRYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSE
DRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGAAMK
TFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIR
FPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKP
QVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Download sequence
Identical sequences H2NME5
ENSPPYP00000007036 9600.ENSPPYP00000007036 ENSPPYP00000007036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]