SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000007963 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000007963
Domain Number 1 Region: 198-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 159-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.76e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 239-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 1-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000196
Family KRAB domain (Kruppel-associated box) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000007963   Gene: ENSPPYG00000007041   Transcript: ENSPPYT00000008294
Sequence length 296
Comment pep:known chromosome:PPYG2:16:3429376:3432467:1 gene:ENSPPYG00000007041 transcript:ENSPPYT00000008294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYFSQEELELLDYTQKTLYNDVMQENYKTIISLALFVLPKPKVISCLEQGEEPWVQVSPE
FKDSAGKSPTGLKLKNDTENHQPVSLSDLEIQASAGIISKKAKVKVPQKTAGKENHFDMH
RVGKWHQDFPVKKRKKLSTWKQELLKLMDRHKKDCAREKPFKCQECGKTFRVSSDLIKHQ
RIHTEEKPYKCQQCDKRFRWSSDLNKHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHT
GEKPFTCHECGKKFSQNSHLIKHRRTHTGEQPYTCSICRRNFSRRSSLLRHQKLHL
Download sequence
Identical sequences H2NPY6
ENSPPYP00000007963 ENSPPYP00000007963 9600.ENSPPYP00000007963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]