SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000008100 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000008100
Domain Number 1 Region: 228-380
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.42e-24
Family DnaQ-like 3'-5' exonuclease 0.001
Further Details:      
 
Domain Number 2 Region: 505-664
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.78e-16
Family Canonical RBD 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000008100   Gene: ENSPPYG00000007163   Transcript: ENSPPYT00000008435
Sequence length 774
Comment pep:known chromosome:PPYG2:16:20225506:20269311:1 gene:ENSPPYG00000007163 transcript:ENSPPYT00000008435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEREGTERHPRKVRKRRQAPNKLVGAAEAMKAGWDLEESQPEAKKARLSTILFTDNCE
VTHDQLCELLKYAVLGKSNVPKPSWCQLFHQNHLNNVVVFVLQGMSQLHFYRFYLEFGCL
RKAFRHKFRLPPPSSDFLADVVGLQTKQRAEDLPETMEGPLPSNAKAAINLQNDPIIQKY
GSKKVGLTRCLLTKEEMRTFHFPLQGFPDCENFLLTKCNGSIADNSPLFGLDCEMCLTSK
GRELTRISLVAEGGCCVMDELVKPENKILDYLTSFSGITKKILHPVTTKLKDVQRQLKAL
LPPDAVLVGHSLDLDLRALKMIHPYVIDTSLLYVREQGRRFKLKFLAKVILGKDIQCPDR
PGHDATEDGRTILELGQYFLKHGPKKIAELNLEALANHQEIQAAGQEPRNTAEVLQHPNT
SVLECLDSVGQKLLFLTRETDAGELPSSRNCQTIKCLSNKEVLEKARVEIPLFPFSIVQF
SFKAFSPVLTEEMNKRMRIKWTEISTVYAGPFSKNCNLRALKRLFKSFGPVQSMTFVLET
RQPHLCIQYEVLEAAQLAIESLDGILVDGICIKVQRPVTELTLDCDTLVNELEGDSENQG
SIYLSGVSETFKEQLLQEPRLFLGLEAVILPKDLKSGKQKKYCFLKFKSFGSAQQALNIL
TGKDWKLKGRHALTPRHLHAWLRGLPPESRRLPGLRVVPPRFEQEALQTLKLDHPKIAAW
RWGRKIGKLYNSLCPGTLCLILLPGTKSTHGSLSGLGLMGIKEEEESAGPGLCS
Download sequence
Identical sequences H2NQB7
9600.ENSPPYP00000008100 ENSPPYP00000008100 XP_002826229.1.23681 XP_002826230.1.23681 XP_009248806.1.23681 ENSPPYP00000008100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]