SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009424 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009424
Domain Number 1 Region: 91-198
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000721
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 509-622
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000015
Family Second domain of FERM 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009424
Domain Number - Region: 400-495
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000155
Family Ras-binding domain, RBD 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009424   Gene: ENSPPYG00000008382   Transcript: ENSPPYT00000009802
Sequence length 756
Comment pep:known chromosome:PPYG2:17:46760372:46769779:1 gene:ENSPPYG00000008382 transcript:ENSPPYT00000009802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPGGLWWLLCCRRGFTLLHRDYGDGELSGDGDEDEDEETFELRTPSPAGGGRGPLEVT
LTQPVRSGPVSNRLQSWEETWSLIPEKGLPEDDPDTVVKGWLYREPRGGGARPWLPPRRA
WFVLTRDSLDQFSSSGKGARRLGSLVLTSLCSVTGPERRRKETGLWSVTVSGRKHSVRLC
SPRQAEAERWGVALREVIASKAPLETPTQLLLRDIQESCGDPEAVALIYLRNPILRHTSG
ALYAPLLPLPYGVSAPGPGYAPLREEAVRLFLALQALEGARRPGPLMQGVLQTCRDLPAL
RDELFLQLAKQTSGPAGPPGLPATQDPAALRYWQLLTCMSCTFRPGGAVRGHLLGHLERT
EQALPDSELAEYARFIRKALGRTRGRELVPSLAEISALSQRQELLCTVHCPGAGACAVAI
DSHTTAGEVARELVGRLGLARSRNAFALYEQRGAQERALAGGTLVADVLTRFENLAAEEA
GLEDSPDSGWRLCLRLHGPLHPEGLSPDGHELPFLFEQAHALLLRGRPPPPDDTLRALAA
LRLQSLHRDFSPRVPLPRLDRLLPPPAPRGGAGRTAGSIAREGGGGAGTAAAVLGGWKRL
RGMGRAEAMATYLALAAQCPGFGAARYDVLELSTEPGGGAPQKLCLGLGAKAMSLSRPGE
TEPIHSVSYGHVAACQLMGPHTLALRVGESQLLLQSPQVEEIMQLVNAYLANPSPERPCS
SSSPPCQDLPDTSPPSQRPGLDEPQGQSGCLGQLQD
Download sequence
Identical sequences H2NTZ4
9600.ENSPPYP00000009424 ENSPPYP00000009424 ENSPPYP00000009424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]