SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000009524 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000009524
Domain Number 1 Region: 131-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-18
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 168-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000376
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 451-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000509
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000009524
Domain Number - Region: 107-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0378
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000009524   Gene: ENSPPYG00000008476   Transcript: ENSPPYT00000009905
Sequence length 509
Comment pep:known chromosome:PPYG2:17:49568910:49672448:1 gene:ENSPPYG00000008476 transcript:ENSPPYT00000009905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDIQTNAELKCTQEQSVPAESPAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKV
KDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNC
DVCGLSCISFNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCN
YACQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKERCRTFLQSTDPGDTASAE
ARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESELIQ
TRMMDQAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAEMSNGAPQELE
KKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQNHIYQQNHMVLPRARNGMPLLKE
VPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPF
ECNMCGYRSHDRYEFSSHIARGEHRALLK
Download sequence
Identical sequences H2NU92
ENSPPYP00000009524 9600.ENSPPYP00000009524 ENSPPYP00000009524 XP_003778910.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]