SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010319 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010319
Domain Number 1 Region: 334-536
Classification Level Classification E-value
Superfamily Caspase-like 3.89e-35
Family Caspase catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 28-138
Classification Level Classification E-value
Superfamily DEATH domain 2.12e-23
Family DEATH domain, DD 0.0044
Further Details:      
 
Domain Number 3 Region: 127-213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000112
Family I set domains 0.047
Further Details:      
 
Domain Number 4 Region: 225-308
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000001
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010319   Gene: ENSPPYG00000009188   Transcript: ENSPPYT00000010727
Sequence length 774
Comment pep:known chromosome:PPYG2:18:71367891:71451561:1 gene:ENSPPYG00000009188 transcript:ENSPPYT00000010727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSERLDQAPEGRGWRRLAEL
AGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQ
LLSPPGIKITINPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAV
HVKDAGFYVCRVNNNFTFEFSQWSQLDVCDVPESFRRSVDGVSESKLQICVEPTSQKLMP
GSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQD
SKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLK
APLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENF
GNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDAL
KVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEELPESM
CLKFDCGVQIQLGFAAEFSNVMIIYTSIVYKPSEIIMCDAYVTDFPLDLDIDPKDANKGT
PEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKP
LIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSN
VTPADSCHCSRTPDAFISSFAHHSSCHFSRSNVPVETTDEIPFSFSDRLRISEK
Download sequence
Identical sequences H2NWF6
9600.ENSPPYP00000010319 ENSPPYP00000010319 ENSPPYP00000010319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]