SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010519 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010519
Domain Number 1 Region: 56-139
Classification Level Classification E-value
Superfamily HMG-box 9.03e-25
Family HMG-box 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010519   Gene: ENSPPYG00000009378   Transcript: ENSPPYT00000010933
Sequence length 252
Comment pep:known chromosome:PPYG2:19:3578961:3585157:1 gene:ENSPPYG00000009378 transcript:ENSPPYT00000010933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHGPKQPGAAAAPAGGKAPGQHGGFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGK
KRKKILPNGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYL
DEAEREKQQYMKELRAYQQSEAYKMCTEKIQEKKVKKEDSSSGLMNTLLNGHKGGDCDGF
STFDVPIFTEEFLDQNKAREAELRRTGETPTLGTLDFYMARLHGAIERDPAQHEKLIVRI
KEILAQVARDHL
Download sequence
Identical sequences H2NX01
9600.ENSPPYP00000010519 ENSPPYP00000010519 ENSPPYP00000010519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]