SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011178 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011178
Domain Number 1 Region: 147-460
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-100
Family Protein kinases, catalytic subunit 0.0000000000161
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 7.61e-25
Family Pleckstrin-homology domain (PH domain) 0.000000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011178   Gene: ENSPPYG00000009986   Transcript: ENSPPYT00000011615
Sequence length 481
Comment pep:known chromosome:PPYG2:19:41375735:41407944:-1 gene:ENSPPYG00000009986 transcript:ENSPPYT00000011615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSTAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
Download sequence
Identical sequences A0A2I2YDQ0 H2NYU6 K7CDC2
9598.ENSPTRP00000018854 9600.ENSPPYP00000011178 XP_002829296.1.23681 XP_004060786.2.27298 XP_009230881.1.23681 XP_016791456.1.37143 XP_016791457.1.37143 XP_016791458.1.37143 XP_016791459.1.37143 XP_016791460.1.37143 XP_016791461.1.37143 XP_018871248.1.27298 XP_018871249.1.27298 XP_018871250.1.27298 XP_018871251.1.27298 XP_018871252.1.27298 XP_018871253.1.27298 XP_018871254.1.27298 XP_018871256.1.27298 ENSPPYP00000011178 ENSPPYP00000011178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]