SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011289 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011289
Domain Number 1 Region: 528-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-27
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-27
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.54e-26
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 626-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 65-123
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000288
Family KRAB domain (Kruppel-associated box) 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011289
Domain Number - Region: 280-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00204
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011289   Gene: ENSPPYG00000010090   Transcript: ENSPPYT00000011729
Sequence length 691
Comment pep:known chromosome:PPYG2:19:45700135:45725951:-1 gene:ENSPPYG00000010090 transcript:ENSPPYT00000011729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVYAGSWKRCAAQDLSTLLCLEESMEEQDDKPPEPPKACAQDSFLPQEIIIKVEGEDT
GSLTIPSQEGVNFKIVTVDFTQEEQGTWNPAQRTLDRDVILENHRDLVSWDLATAVGKKD
STSKQRIFDEELANGVKIERFTRDDPWLSSCEEVGDYKDQLEKQQEKQEILLQEVAFTQR
KAVIHERVCKSGEPGEKSDLNSNLFSSPIIPIRNHIHKHVSHAKKWHLNSAVNSHQKINE
NETLYENNECGKPPQSIHLIQFTRTQTKDKSYGFSDSIQSFCHGTPLHIHEKIHGRGKTF
DFKECGQVLNPKISHNEQQRIPFEESQYKCSETSHSSSLTQNMRNNSEEKPFECNQCGKS
FSWSSHLVAHQRTHTGEKPYECSECGKSFSRSSHLVSHQRTHTGEKPYRCNQCGKSFSQS
YVLVVHQRTHTGEKPYECNQCGKSFRQSYKLIAHQRTHTGEKPYECNQCGKSFIQSYKLI
AHQRIHTGEKPYECNQCGKSFSQSYKLVAHQRTHTGEKPFECNQCGKSFSWSSQLVAHQR
THTGEKPYECSECGKSFNRSSHLVMHQRIHTGEKPYECNQCGKSFSQSYVLVVHQRTHTG
EKPYECSQCGKSFRQSSCLTQHQRTHTGEKPFECNQCGKTFSLSARLIVHQRTHTGEKPF
TCIQCGKAFINSYKLIRHQATHTEEKLYECN
Download sequence
Identical sequences H2NZ55
9600.ENSPPYP00000011289 ENSPPYP00000011289 ENSPPYP00000011289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]