SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011295 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011295
Domain Number 1 Region: 234-320
Classification Level Classification E-value
Superfamily SH2 domain 1.18e-47
Family SH2 domain 0.0000127
Further Details:      
 
Domain Number 2 Region: 10-147
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 1.57e-43
Family N-terminal domain of cbl (N-cbl) 0.00039
Further Details:      
 
Domain Number 3 Region: 148-233
Classification Level Classification E-value
Superfamily EF-hand 5.3e-37
Family EF-hand modules in multidomain proteins 0.00011
Further Details:      
 
Domain Number 4 Region: 335-360
Classification Level Classification E-value
Superfamily RING/U-box 0.00000565
Family RING finger domain, C3HC4 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011295   Gene: ENSPPYG00000010096   Transcript: ENSPPYT00000011735
Sequence length 430
Comment pep:known chromosome:PPYG2:19:45993455:46012760:1 gene:ENSPPYG00000010096 transcript:ENSPPYT00000011735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAVAPWGRQWEEARALGRAVRMLQRLEEQCGDPRLSISPPSLRDLLPRTAQLLREVAH
SRRAAGGGGPGGPGGCGDFLLIYLANLEAKGRQVAALLPPRGRRSANDELFRAGSRLRRQ
LAKLAIIFSHMHAELHALFPGGKYCGHMYQLTKAPAHIFWRERCGARCVLPWAEFESLLG
TCHPVEPGCTALALRTTIDLTCSRHVSIFEFDVFTRLFQPWPTLLKNWQLLAVNHPGYMA
FLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSSDGSILQTIPANKPLSQVLLE
GQKDGFYLYPDGKNHNPDLTELGQAEPQQRIHVSEHSDSQTCPFCRCEIKGWEAVSIYQF
HGEATAEDSGDSSDQEGRELELGQVPLSAPPLPPRPDLPPRKPRNSQPKVRLLKGNSPPA
ALGPQDPAPA
Download sequence
Identical sequences H2NZ61
ENSPPYP00000011295 9600.ENSPPYP00000011295 ENSPPYP00000011295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]