SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011376 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011376
Domain Number 1 Region: 163-665
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.99e-82
Family RNA helicase 0.062
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011376
Domain Number - Region: 1067-1077,1110-1142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0103
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011376   Gene: ENSPPYG00000010172   Transcript: ENSPPYT00000011818
Sequence length 1143
Comment pep:known chromosome:PPYG2:19:48769401:48801092:1 gene:ENSPPYG00000010172 transcript:ENSPPYT00000011818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPRTREGRDRRDHHRAPSEEEALEKWDWNCPETRRLLEDAFFREEDYIRQGSEECQKF
WTFFERLQRFQNLKTSRKEEKDPGQPKHSIPALADLPRTYDPRYRINLSVLGPATRGSQG
LGRHLPAERVAEFHRALLHYLDFGQKHAFGRLAKLQRERAALPIAQYGNRILQTLKEHQV
VVVAGDTGCGKSTQVPQYLLAAGFSHVACTQPRRIACISLAKRVGFESLSQYGSQVGYQI
RFESTRSAATKIVFLTVGLLLRQIQREPSLPQYEVLIVDEVHERHLHNDFLLGVLRRLLS
TRPDLKVILMSATINISLFSSYFSNAPVVQVPGRLFPITVVYQPQEAEPTTSKSEKLDPR
PFLRVLESIDHKYPPEERGDLLVFLSGMAEISTVLKAAQTYASHTQRWVVLPLHSALSVA
DQDKVFDVAPPGVRKCILSTNIAETSVTIDGIRFVVDSGKVKEMSYDPQAKLQRLQEFWI
SQASAEQRKGRAGRTGPGVCFRLYAESDYDAFAPYPVPEIRRVALDSLVLQMKSMSVGDP
RTFPFIEPPPPASLETAILYLRDQGALDSSEALTPIGSLLAQLPVDVVIGKMLILGSMFS
LVEPVLTIAAALSVQSPFTRSAQSSPECAAARRPLESDQGDPFTLFNVFNAWVQVKSERS
RNSRKWCRRRGIEEHRLYEMANLRRQFKELLEDHGLLAGAQAAQVGDSYSRLQQRRERRA
LHQLKRQHEEGTGRRRKVLRLQEEQDGGSSDEDRASPAPPGASDGVDIQDVKFKLRHDLA
QLQAAASSAQDLSHEQLALLKLVLGRGLYPQLAIPDAFNNSRKDSDQIFHTQAKQGAVLH
PTCVFAGSPEVLHTQELEASSCDGSQDDKDKMSSKHQLLSFVSLLETNKPYLVNCVRIPA
LQSLLLFSRSLDTNGDCSRLVADGWLELQLADSESAVRLLAASLRLRARWESALDRQLVH
QAQRRLEEEEQDVPVSPKEVATLSKELLQFTASKIPYSLRRLTGLEAQNMYVGPHTIPAT
PHLPGLFGSSTLSPHPTKGGYAVTDFLTYNCLTSDTDLYSDCLRTFWTCPHCGLHAPLTP
LERITHENTCPQAPQDGPPGAEEAAPETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRK
QHM
Download sequence
Identical sequences H2NZD6
ENSPPYP00000011376 ENSPPYP00000011376 9600.ENSPPYP00000011376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]