SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011397 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011397
Domain Number 1 Region: 2-49
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.72e-20
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 2 Region: 309-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.16e-19
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 355-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000519
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011397   Gene: ENSPPYG00000010192   Transcript: ENSPPYT00000011839
Sequence length 411
Comment pep:known chromosome:PPYG2:19:49811261:49815821:1 gene:ENSPPYG00000010192 transcript:ENSPPYT00000011839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLVTFTDVAVNFTKEEWTLLDSAQRNLYRDVMLENSRNLAFIDWATPCKTKDATPQPDIL
PKRTFPEANRVCLKSISSQLSTLREDWRCPKTEEPHRQGVNNVKPPAAAPEKDESPVSIC
EDREVRNHSKPTCKLVPSQGDSIRQCILTYDSSIFKYNPVLNDSQKTHENNKHNGVLGGN
IQWVPCGRKTELKSSTWTGSQNTVHHIRDEIDMGANRHQRNPFGKAFCEDGSFRAHNTHV
RDKMCDFTQCENTSRNNSIHAVQMQSYPQKTIRKDCQTGATSADAPNSGSHKSHCTGEKT
HKCPECGRAFFYQSFLMRHMKIHTGEKPYECGKCGKAFRYSLHLNKHLRKHVVQKKPYEC
EECGKVIRESSKYTHLRSLTGEKPYKCKTCGKDFAFSSRLKKHLKTHKKKK
Download sequence
Identical sequences H2NZF6
9600.ENSPPYP00000011397 ENSPPYP00000011397 ENSPPYP00000011397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]