SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011568 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011568
Domain Number 1 Region: 194-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 278-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 20-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-23
Family KRAB domain (Kruppel-associated box) 0.00076
Further Details:      
 
Domain Number 4 Region: 320-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 142-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-16
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 6 Region: 241-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000216
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011568   Gene: ENSPPYG00000010328   Transcript: ENSPPYT00000012011
Sequence length 484
Comment pep:novel chromosome:PPYG2:19:53318484:53326547:-1 gene:ENSPPYG00000010328 transcript:ENSPPYT00000012011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNATIVMSVRREQGSSSGEGSLSFEDVAVGFTREEWQFLDQSQKVLYKEVMLENYSNLV
SVGYQGTKPDSLFKLEQGEPPWIVEGAAHSQICPGFVIQNRRYAGKVSDAFGGYGKSCLH
IKHDKTLTRVKYHRCVKPSSPKSQLSDLQKICAGEKPHECSVCGRAFSRKAQLIQHQRTE
RGEKPHGCGECGKTFMRKIQLTEHQRTHTGEKPHECSECGKAFSRKSQLMVHQRTHTGEK
PYRCSECGKAFSRKCRLNRHQQSHTGEKLYGCSVCGKAFSQKAYLIVHQRLHTGDKPYKC
SDCGRTFCFKSDLTRHQRIHTGEKPYECSECEKAFRSKSKLIQHQRIHTGERPYSCSECG
KAFAHMSVLIKHKKIHIRETAINSLKVEKPSSRSHTSLYMSELIQEQKTMNTVPIEMPSS
GTPPLLNKSEHLVGRNVVIVEQPFPRNQAFVVNQEFEQRISLTNEVNVVPSVINYILYLT
DIVE
Download sequence
Identical sequences H2NZX4
ENSPPYP00000011568 ENSPPYP00000011568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]