SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011728 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011728
Domain Number 1 Region: 365-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.36e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 595-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-21
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 308-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 465-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-19
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 406-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 6-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-18
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 7 Region: 636-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 538-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 722-780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000202
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 10 Region: 235-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000607
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 11 Region: 693-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000606
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 12 Region: 203-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000218
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011728
Domain Number - Region: 135-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000199
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011728   Gene: ENSPPYG00000010466   Transcript: ENSPPYT00000012174
Sequence length 780
Comment pep:novel chromosome:PPYG2:19:59461325:59496938:1 gene:ENSPPYG00000010466 transcript:ENSPPYT00000012174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMDAGQDCMVFEDVAIHFSQEEWGILNHVQRHLHSDVMLENFALLSSVGCWHGAKDEEV
PSKQCVSVRVLQVTTPKPALSTLKAQPCKTCSSLLKDILHLAEHDGTHPEQGLYTCAAEH
DLHQKEQIREKLTRSDEWRPSFVNHSAHMGERNFTCTQGGKDFTASSDLLQQQVLNSGWK
LYRDTQDGEGFQGEQNDFNSSQGGKDFCHQHRLFEHQKTHNGERPYEFSECEELFRYNSN
LIKYQQNHAGERPYEGTEYGKTFIRKSNLVQHQKIHSEGFLSKRSDPIEHQEIRRRPTPY
ECTQCGKAFLTQADLVGHQKTHTGEQPYECNKCGKFFMYNSKLIRHQKVHTGERHYECSE
CGKLFMDSFTLGRHQRVHTGERPFECSICEKFFSHRSTLNMHQRVHTGKRPYKCSECGKA
FSLKHNVVQHLKIHTGERPYECTECEKAFVRKSHLIQHQKIHTDAFSKRSDLIQHKKIDI
RLRPYACSECGKAFLTQAHLVGHQKIHTGERPYECTQCAKAFVRKSHLVQHQKIHTDAFS
KRSDLIQHERIDLRPRPYVCGECGKAFLTQAHLDGHQKIQTEEWPYECNECGKFFLDSYK
LVIHQRIHTGEKPYKCSKCGKFFGYRCTLSRHQKVHTGERPYECSECGKFFRDSYKLIIH
QRVHTGEKPYECSNCGKFLRYRSTFIKHHKVCTGEKPHECSKCRELFRTKSSLIRHQQSH
TGESPFKLRECGKDFNKCNTGQRQKTHTGERSYECGECSKVFKYNSSLIKHQRIHTGKRP
Download sequence
Identical sequences H2P0D0
ENSPPYP00000011728 ENSPPYP00000011728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]