SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011770 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011770
Domain Number 1 Region: 251-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 308-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-21
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 3 Region: 13-72
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-20
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 4 Region: 195-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 353-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.45e-17
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 140-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000392
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011770   Gene: ENSPPYG00000010503   Transcript: ENSPPYT00000012218
Sequence length 422
Comment pep:known chromosome:PPYG2:19:60533816:60543414:1 gene:ENSPPYG00000010503 transcript:ENSPPYT00000012218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEAEAQLDPSLQGLVMFEDVTVYFSRDEWGLLNVTQKGLYRDVMLENFALVSSLGLAS
SRSPVFTQLEDDEQSWVPSWVDVTPVSRAEARRGFGLDGLCRVEDERARPEHLKSYRVIQ
HQDTHSEGKPRRHTEHGTAFPPGSSCGQQQEVHVAEKLFKCSDCGKVFLKAFALLDHLIT
HSEERPFRCPTGRSAFKEKSAHINPRKIHTGETAHVCNECGKAFSYPSKLRKHQKVHTGI
KPFKCSDCGKTFNRKDALVLHQRIHTGERPYECSKCGKTFSVLSTLIRHRKVHIGERPYE
CTECGKFFKYNNSFILHQRVHTGERPFECKQCGKGYVTRSGLYQHWKVHTGERPYECSLC
GKTFTTRSYRNRHQQFHTEERSYECTECGKAFKHSSTLLQHKKVHTPERPQEDRSHGKVV
SC
Download sequence
Identical sequences H2P0H0
ENSPPYP00000011770 9600.ENSPPYP00000011770 XP_002829959.1.23681 ENSPPYP00000011770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]