SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012176 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012176
Domain Number 1 Region: 249-440
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.17e-46
Family Protein kinases, catalytic subunit 0.0000000103
Further Details:      
 
Domain Number 2 Region: 114-241
Classification Level Classification E-value
Superfamily SH2 domain 1.15e-38
Family SH2 domain 0.00000175
Further Details:      
 
Domain Number 3 Region: 77-118
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000379
Family SH3-domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012176   Gene: ENSPPYG00000010900   Transcript: ENSPPYT00000012655
Sequence length 449
Comment pep:known chromosome:PPYG2:20:29259294:29306944:1 gene:ENSPPYG00000010900 transcript:ENSPPYT00000012655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGGRSSCEDPGCPRDEERAPRMGCMRSKFLQVGGNTFSKSETSANPHCPVYVPDPTSTIK
PGPNSNNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDKMVVLEESGEWWKARSL
ATGKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSY
SLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP
CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
AFLAEANVMKTLQHDKLVKLHAVVTEEPIYIITEFMAKGAKFPIKWTAPEAINFGSFTIK
SDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPENCPEELYNIMMRCWKNR
PEERPTFEYIQSVLDDFYTATESQYQQQP
Download sequence
Identical sequences H2P1L5
9600.ENSPPYP00000012176 ENSPPYP00000012176 ENSPPYP00000012176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]