SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012299 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012299
Domain Number 1 Region: 103-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-20
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 766-834
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000376
Family Homeodomain 0.00047
Further Details:      
 
Domain Number 3 Region: 498-555
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000423
Family Homeodomain 0.0069
Further Details:      
 
Domain Number 4 Region: 613-674
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000727
Family Homeodomain 0.0008
Further Details:      
 
Domain Number 5 Region: 315-370
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000642
Family Homeodomain 0.01
Further Details:      
 
Domain Number 6 Region: 846-887
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000941
Family Homeodomain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000012299
Domain Number - Region: 77-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00417
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012299   Gene: ENSPPYG00000011012   Transcript: ENSPPYT00000012780
Sequence length 956
Comment pep:known chromosome:PPYG2:20:38503454:38527044:-1 gene:ENSPPYG00000011012 transcript:ENSPPYT00000012780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKRKSTTPCMIPVKTVVLQDASMEAQPAETLPEGPQQDLPPEASAASSEAAQNPSSTD
GSALANGHRSTLDGYLYSCKYCDFRSHDMTQFVGHMNSEHTDFNKDPTFVCSGCSFLAKT
PEGLSLHNATCHSGEASFVWNVAKPDNHVVVEQSIPESTSTPDLAGEPSAEGADGQAEII
ITKTPIMKIMKGKAEAKKIHTLKENVPSQPVGEALPKLSTGEMEVREGDHSFINGAVPVS
QASASSAKTPHAANGPLIGTVPVLPAGIAQFLSLQQQPPVHAQHHAHQPLPTAKALPKVM
IPLSSIPTYNAAMDSNSFLKNSFHKFPYPTKAELCYLTVVTKYPEEQLKIWFTAQRLKQG
ISWSPEEIEDARKKMFNTVIQSVPQPTITVLNTPLVASAGNVQHLIQAALPGHVVGQPEG
TGGGLLVTQPLMANGLQATNSSLPLTVTSVPKQPGVAPINTVCSNTTSAVKVVNAAQSLL
TACPSITSQAFLDASIYKNKKSHEQLSALKGSFCRNQFPGQSEVEHLTKVTGLSTREVRK
WFSDRRYHCRNLKGSRAMMPGDHSSIIIDSVPEVSFSPSSKVPEVTCIPTAATLATHPSA
KRQSWHQTPDFTPTKYKERAPEQLRALESSFAQNPLPLDEELDRLRSETKMTRREIDSWF
SERRKKVNAEETKKTEENPSQEEEEAAEDEGGEEDLASELRVSGENGSLEMPSSHTLAER
KVSPIKINLKNLRVTEANGRNEIPGLGACDPEDDGSNKLAEQLPGKVSCKKTAQQRHLLR
QLFVQTQWPSNQDYDSIMAQTGLPRPEVVRWFGDSRYALKNGQLKWYEDYKRGNFPPGLL
VIAPGNRELLQDYYMTHKMLYEEDLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSE
DQGPGTGELTAVHKGMGDTYSEVSENSESWEPSVPEASSEPFDTSSPQAGRQLETD
Download sequence
Identical sequences H2P1Y1
ENSPPYP00000012299 9600.ENSPPYP00000012299 XP_009231866.1.23681 ENSPPYP00000012299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]