SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012534 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012534
Domain Number 1 Region: 182-240
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000034
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012534   Gene: ENSPPYG00000011219   Transcript: ENSPPYT00000013028
Sequence length 285
Comment pep:known chromosome:PPYG2:20:61203072:61223133:-1 gene:ENSPPYG00000011219 transcript:ENSPPYT00000013028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVTLIRHPSELVNVPLHQQQNKCTTLVKNKTAATTTALQFTYPLFTTNACSTSGNSNLSQ
TQSFSNSCSILEAAKHQDIGLPRAFSFCYQQEIESTKQTLGSRNKVLPEQVWIKVGEEAL
CKQALKRNRNRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQ
GGRSQRRERHNRMERDRRRRIRICCDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHG
DSLKKEFESVFCGKTGRRLKLTRPDSLVTCAAQGSLQSSPSLEIK
Download sequence
Identical sequences H2P2K0
9600.ENSPPYP00000012534 ENSPPYP00000012534 ENSPPYP00000012534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]