SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000012556 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000012556
Domain Number 1 Region: 218-483
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.28e-77
Family Protein kinases, catalytic subunit 0.0000002
Further Details:      
 
Domain Number 2 Region: 115-249
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-34
Family SH2 domain 0.0003
Further Details:      
 
Domain Number 3 Region: 39-164
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000214
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000012556   Gene: ENSPPYG00000011239   Transcript: ENSPPYT00000013052
Sequence length 489
Comment pep:known chromosome:PPYG2:20:61951366:61958280:-1 gene:ENSPPYG00000011239 transcript:ENSPPYT00000013052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPFLRRRLAFLSFFWDKIWPTGDEPDHGTPGSLDPDADPVPALPTEPCGPFPQLFLALY
DFTARCGGELSVRRGDRLCALEEGGGYIFARRLSGQPRTGLVPIIHVAKAAPETLSDQPW
YFSGVSRTQAQQLLLSPPNEPGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLY
LQKGRLFPGLEELLTYYKANWKLIQNPLLQPCVPQKAPRQDAWERPHSEFALGRKLGEGY
FGEVWEGLWLGSLPVAIKVIKSADMKLTDLAKEIQTLKGLRHERLIRLHAVCSGGEPVYI
VTELMRKGNLQAFLGSPEGRALRLPPLLGFACQVAEGMNYLEEQRIVHRDLAARNVLVDD
GLACKVADFGLARLLKDDIYSPSSSSKIPVKWTAPEAANYRVFSQKSDVWSFGVLLYEVF
TYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKL
HAIHRCRPP
Download sequence
Identical sequences H2P2M2
ENSPPYP00000012556 ENSPPYP00000012556 9600.ENSPPYP00000012556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]