SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013818 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013818
Domain Number 1 Region: 7-188
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.59e-76
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000396
Further Details:      
 
Domain Number 2 Region: 183-304
Classification Level Classification E-value
Superfamily E set domains 4.9e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013818   Gene: ENSPPYG00000012391   Transcript: ENSPPYT00000014378
Sequence length 587
Comment pep:known chromosome:PPYG2:2a:49985732:50027585:-1 gene:ENSPPYG00000012391 transcript:ENSPPYT00000014378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAII
TRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
AIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLF
QKLCQDHVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPG
PISSGLSHHASMAPLPSSSWSSVPHPTPRSGNTNPLSSFSTGTLPSNSQGIPPFLRIPVG
NDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSNDSMGETDNP
RLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFNCGDN
SMINESGPSNSANPNSHGFVQGSQYSGIGSMQNEQLSDSFPYEFFQV
Download sequence
Identical sequences H2P645
ENSPPYP00000013818 9600.ENSPPYP00000013818 ENSPPYP00000013818 XP_002812051.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]