SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000013933 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000013933
Domain Number 1 Region: 525-1001
Classification Level Classification E-value
Superfamily Ras GEF 3.27e-141
Family Ras GEF 0.0000000000000104
Further Details:      
 
Domain Number 2 Region: 156-358
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.55e-43
Family DBL homology domain (DH-domain) 0.00000000284
Further Details:      
 
Domain Number 3 Region: 376-531
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-39
Family Pleckstrin-homology domain (PH domain) 0.000000458
Further Details:      
 
Domain Number 4 Region: 7-135
Classification Level Classification E-value
Superfamily Histone-fold 9.64e-39
Family TBP-associated factors, TAFs 0.00000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000013933   Gene: ENSPPYG00000012474   Transcript: ENSPPYT00000014498
Sequence length 1290
Comment pep:known chromosome:PPYG2:2a:72605989:72742277:1 gene:ENSPPYG00000012474 transcript:ENSPPYT00000014498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAQQLPYEFFSEENAPKWRGLLVPALKKERVQKSFPHPIDKWAIADAQSAIEKRKRRNP
LSLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDI
KVAMCADKVLMDMFHQDVEDINVLSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLI
IKVFREPFVSNSKLFSANDVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSC
FEDLAEELAFDPYESYARDILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRL
LLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSE
SACRFYSQQMKGKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIF
LFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDEN
SVIFSAKSAEEKNNWMAALISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDS
EENIIFEENMQPKAGIPIIKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLS
LIIERFEIPEPEPTEADRIAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFY
DFERDAYLLQRMEEFIGTVRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVE
WHISRPGHIETFDLLTLHPIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLL
KMIRHTTNLTLWFEKCIVETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSP
VYRLDHTFEQIPSRQKKILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEE
GNPEVLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSME
KEFTDYLFNKSLEIEPRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRK
ISYSRIPESETESTASAPNSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSNDTVFI
QVTLPHGPRSASVSSISLTKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAI
PPRQPTSKAYSPRYSISDRTSVSDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKD
HGNAFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIP
KLPPKTYKREHTHPSMHRDGPPLLENAHSS
Download sequence
Identical sequences H2P6F7
ENSPPYP00000013933 ENSPPYP00000013933 9600.ENSPPYP00000013933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]