SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014265 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014265
Domain Number 1 Region: 621-912
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.14e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000862
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-40
Family Third domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-37
Family Second domain of FERM 0.0000737
Further Details:      
 
Domain Number 4 Region: 27-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.05e-22
Family First domain of FERM 0.0012
Further Details:      
 
Domain Number 5 Region: 510-603
Classification Level Classification E-value
Superfamily PDZ domain-like 1.26e-18
Family PDZ domain 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014265   Gene: ENSPPYG00000012784   Transcript: ENSPPYT00000014846
Sequence length 925
Comment pep:known chromosome:PPYG2:2b:14550476:14771323:-1 gene:ENSPPYG00000012784 transcript:ENSPPYT00000014846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDIVFK
HLDLTEQDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPSNTAALLASFAVQSELGDYDQSENLPGYLSDYSFIPNQ
PQDFEKEIAKLHQQHIGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGG
ILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSLSDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLV
DHMVHTSPSEVFVNQRSPSSTQANSIVLESSPSQETPGDGKPPALPPKQSKKNSWNQIHY
SHSQQDLESHINETFDIPSSPEKPTPNGGIPHDNLVLIRMKPDENGRFGFNVKGGYDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDVVLFIKASCERHSGELMLLV
RPNAVYDVVEEKLENEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQFDQ
LYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSIIN
QYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQV
TCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNKR
AGKEEPIVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQY
RFVCEAILKVYEEGFVKPLTTSSNK
Download sequence
Identical sequences H2P7C3
ENSPPYP00000014265 ENSPPYP00000014265 9600.ENSPPYP00000014265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]