SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014424 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014424
Domain Number 1 Region: 310-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.05e-16
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Domain Number 2 Region: 343-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000507
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014424   Gene: ENSPPYG00000012923   Transcript: ENSPPYT00000015010
Sequence length 398
Comment pep:known chromosome:PPYG2:2b:60833514:60835576:1 gene:ENSPPYG00000012923 transcript:ENSPPYT00000015010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAVLRNDSLQAFLQDRTPSASPDLGKHSPLALLAATCSRIGQPGATAPPDFLQVPYD
PALGSPSRLFHPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPS
YPYEFSPVKMLPSSMAALPASCAPAYVPYAAQAALPPGYSNLLPPPPPPPPPPTCRQLSP
NPAPDDLPWWSIPQAGAGPGASGVPGSGLSGACAGGPHAPRFPASAAAAAAAAAALQRGL
VLGPSDFAQYQSQIAALLQTKAPLAATARRCRRCRCPNCQAAGGAPEAEPGKKKQHVCHV
PGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFACPE
CGKRFMRSDHLAKHVKTHQNKKLKVAEAGVKREDARDL
Download sequence
Identical sequences H2P7S8
ENSPPYP00000014424 ENSPPYP00000014424 XP_002812621.1.23681 9600.ENSPPYP00000014424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]