SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014600 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014600
Domain Number 1 Region: 233-477
Classification Level Classification E-value
Superfamily Caspase-like 4.49e-58
Family Caspase catalytic domain 0.00019
Further Details:      
 
Domain Number 2 Region: 90-187
Classification Level Classification E-value
Superfamily DEATH domain 2.47e-22
Family DEATH effector domain, DED 0.0085
Further Details:      
 
Domain Number 3 Region: 5-74
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000441
Family DEATH effector domain, DED 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014600   Gene: ENSPPYG00000013068   Transcript: ENSPPYT00000015190
Sequence length 480
Comment pep:known chromosome:PPYG2:2b:92379117:92430283:1 gene:ENSPPYG00000013068 transcript:ENSPPYT00000015190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLY
RVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYM
GRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGT
SYRNVLQAAIQKSFKDPSNNFRLHNGRSKEQRLKEQLGTQQEPVKKSIQESEAFLPQSVP
EERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP
EHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKIFFIQNY
VVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADVSLLEWSHSSP
SLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
Download sequence
Identical sequences H2P897
ENSPPYP00000014600 ENSPPYP00000014600 9600.ENSPPYP00000014600 XP_009236236.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]