SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014602 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014602
Domain Number 1 Region: 275-513
Classification Level Classification E-value
Superfamily Caspase-like 1.64e-77
Family Caspase catalytic domain 0.000000571
Further Details:      
 
Domain Number 2 Region: 19-124
Classification Level Classification E-value
Superfamily DEATH domain 7.89e-25
Family DEATH effector domain, DED 0.0041
Further Details:      
 
Domain Number 3 Region: 112-188
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000259
Family DEATH effector domain, DED 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014602   Gene: ENSPPYG00000013070   Transcript: ENSPPYT00000015193
Sequence length 521
Comment pep:known chromosome:PPYG2:2b:92445186:92484579:1 gene:ENSPPYG00000013070 transcript:ENSPPYT00000015193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSQGQHWCSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCVGLVPNKKLEKSSSASD
VFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLSYTKEEVEGLLPTRQRVSLFRNLLY
ELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFPAFLEKQGKIDEDNLTCLEDLKTVVPKL
LRNIEKYKREKAVQIVTPPIDKEAESYQGEEELVSQTDVKTFLEALPQEESWQNKHAGSN
GNRATNGAPSLVSRGMQGASANTLNSETGTKGRKGYRMNRNHRGLCLLNNHSFTSLKDRR
GTHKDAEILSHVFQWLGFTVHIHNNVTKGEMEEVLQEQKCNPAHADGDCFVFCILTHGKF
GAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQ
PPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSILT
AVNDDVSRRVDKQGTKKQMPQPAFTLRKKLVFPVPLDALSL
Download sequence
Identical sequences H2P899
ENSPPYP00000014602 ENSPPYP00000014602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]