SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000014726 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000014726
Domain Number 1 Region: 1528-1580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000922
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 1488-1543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000003
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 1435-1483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000572
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 399-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000147
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 440-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000129
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 6 Region: 1163-1215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000907
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 161-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000045
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 8 Region: 1389-1449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000297
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 9 Region: 200-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000202
Family Classic zinc finger, C2H2 0.077
Further Details:      
 
Domain Number 10 Region: 832-883
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000094
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 11 Region: 1570-1613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00002
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 12 Region: 1226-1274
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000209
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000014726
Domain Number - Region: 1296-1343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00219
Family Classic zinc finger, C2H2 0.057
Further Details:      
 
Domain Number - Region: 482-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00491
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 543-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00509
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number - Region: 1140-1172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00955
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 343-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0486
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 1074-1094
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0501
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000014726   Gene: ENSPPYG00000013178   Transcript: ENSPPYT00000015323
Sequence length 1656
Comment pep:known chromosome:PPYG2:2b:110490475:110512928:-1 gene:ENSPPYG00000013178 transcript:ENSPPYT00000015323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPLLDSQPANSTGEMDGLCPELLLIPPPLSNRGILGPVQSPCPSGDPAPIPTEPGCLL
VEATATEEGPGNMEIIVEAVAGTLTPGAPGETPAPKLPPGEREASQEAGTPLPGQETAEE
ENIEKEEKSDTQKDSQKAVDKGQGAQQLEGDVVSGTESLFKTHMCPECKRCFKKRTHLVE
HLHLHFPDPSLQCPNCQKFFTSKSKLKTHLLRELGEKAHHCPLCHYSAVERNALNRHMAS
MHEDISNFYSDTYACPVCREEFRLSQALKEHLKSHTAAAAAEPLPLRCFQEGCSYAAPDR
KAFIKHLKETHGVRAVECRHHSCPMLFATAEAMEAHHKSHYAFHCPHCDFACSNKHLFRK
HKKQGHPGSEELRCTFCPFATFNPVAYQDHVGKMHAHEKIHQCPECNFATAHKRVLIRHM
LLHTGEKPHKCELCDFTCRDVSYLSKHMLTHSNTKDYMCTECGYVTKWKHYLRVHMRKHA
GDLRYQCNQCSYRCHRADQLSSHKLRHQGKSLMCEVCAFACKRKYELQKHMASQHHPSTP
APLYPCHYCSYQSRHKQALLSHENCKHTRLREFHCALCDYRTFSNTTLLFHKRKAHGYVP
GDQAWQLRYASEPEGAMQGPTPPPDEPSNQLSARPEGSGHEPGTVVDPSLDQALPEMSEE
VNTGRQEGSEAPHGDDLGGSPSPAEVEEGSCTLHLEALRVELESVTEPPLEEVTETAPME
FRPLGLEGPDGLEGPELSSFEGIGTSDLGAEENPLLEKPVSELSTNPPSLEEAPNNWVAT
FKATPPAETAPLPPLPESESLLKALRRQDKEQAEALVLEGRVQMVVIQGEGRAFRCPHCP
FITRREKALNLHSRTGCQGRREPLLCPECGASFKQQRGLSTHLLKKYPVLLRKNKGLPRP
SPIPLQAVLPGTQASEDSEGGKPPPAPLEAEKDAPLQLPRPEETEEPLATVSSPPPAGNS
LPTEAKTHCFDRVPPAGNSSPTEALKKHRFEQGKFHCNSCPFLCSRLSSITSHVAEGCRG
GRGGGGKRGTPHTQPDVSPLCNGDSAPPKNGSTESSSGDGDTVLVQKQKGARFSCPTCPF
SCQQERALRTHQTRGCPLEESGELHCSLCPFTAPAAAALRLHQKRRHPTAAPARGPRPHL
QCGDCGFTCKQSRCMQQHRRLKHEGVKPHQCPFCDFSTTRRYRLEAHQSRHTGIGRIPCS
SCPQTFGTNSKLRLHRLRVHDKTPTHFCPLCDYSGYLRHDITRHVNSCHQGTPAFACSQC
EAQFSSETALKQHALRRHPEPAQPAPGSPAETTEGPLHCSRCGLLCPSPASLRGHTRKQH
PRLECGACQEAFPSRPALDEHRRQQHFSHRCQLCDFAARERVGLVKHYLEQHEETSAAVA
APDGDGDAGQPPLHCPFCDFTCRHQLVLDHHVKGHGGTRLYKCTDCAYSTKNRQKITWHS
RIHTGEKPYHCHLCPYACADPSRLKYHMRIHKEERKYLCPECGYKCKWVNQLKYHMTKHT
GLKPYQCPECEYCTNRADALRVHQETRHREARAFMCEQCGKAFKTRFLLRTHLRKHSEAK
PYVCNVCHRAFRWAAGLRHHALTHTDRHPFFCRLCNYKAKQKFQVVKHVRRHHPDQADPN
QGVGKDPTTPTVHLHDVQLEDPSPPAPAAPHTGPEG
Download sequence
Identical sequences H2P8L4
ENSPPYP00000014726 9600.ENSPPYP00000014726 ENSPPYP00000014726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]