SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015183 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015183
Domain Number 1 Region: 41-169
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 8.24e-57
Family N-terminal domain of cbl (N-cbl) 0.00000141
Further Details:      
 
Domain Number 2 Region: 256-342
Classification Level Classification E-value
Superfamily SH2 domain 2.8e-47
Family SH2 domain 0.00000425
Further Details:      
 
Domain Number 3 Region: 349-426
Classification Level Classification E-value
Superfamily RING/U-box 1.04e-42
Family RING finger domain, C3HC4 0.0000109
Further Details:      
 
Domain Number 4 Region: 171-255
Classification Level Classification E-value
Superfamily EF-hand 6.8e-37
Family EF-hand modules in multidomain proteins 0.0000106
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000015183
Domain Number - Region: 926-969
Classification Level Classification E-value
Superfamily UBA-like 0.000148
Family UBA domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015183   Gene: ENSPPYG00000013580   Transcript: ENSPPYT00000015788
Sequence length 982
Comment pep:known chromosome:PPYG2:3:27104789:27322151:1 gene:ENSPPYG00000013580 transcript:ENSPPYT00000015788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSTNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFG
TNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHL
GSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLN
SQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLGIYLKGDVFDSASDPVPLPP
ARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG
SSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQ
APARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNV
EVARSILREFAFPPPVSPRLNL
Download sequence
Identical sequences H2P9U4
ENSPPYP00000015183 XP_002813377.1.23681 XP_002813378.1.23681 ENSPPYP00000015183 9600.ENSPPYP00000015183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]