SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015274 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015274
Domain Number 1 Region: 192-441
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.14e-48
Family Protein kinases, catalytic subunit 0.00091
Further Details:      
 
Domain Number 2 Region: 3-95
Classification Level Classification E-value
Superfamily DEATH domain 5.59e-27
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015274   Gene: ENSPPYG00000013662   Transcript: ENSPPYT00000015883
Sequence length 625
Comment pep:known chromosome:PPYG2:3:59675943:59757152:-1 gene:ENSPPYG00000013662 transcript:ENSPPYT00000015883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITREL
LWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASV
KKAENEQEEGQPVRMATSPGPGSSPARAHQPAFLQPPEEDAPHSLRTDLPTSSDSKDFST
SIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNHKISQGTFADVYRGYRHGTPFVFKKLR
ETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQFHSFIYPYMANGSLQDRLQG
QGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPKLAHPMAHLCP
VNKRSKYTMMKTHLFRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRS
PVYLKDLLLSEIPSSTASPCSRKTGVENVMAKEICQKYLEKGAGRLPEDCAEALATAACL
CLRKRNTSLQEVRGSVAAVEEWLRGREMLLPWSGLSEGTGSSSNTPEETDDVDNSSLDAS
SSVSVAPWAGAATPLLPTENGEGRLRVIVGREADSSSEACVGPEPPQDVTETSWQIDINE
AKRKLMENILLYKEEKLDSIELFGP
Download sequence
Identical sequences H2PA31
ENSPPYP00000015274 ENSPPYP00000015274 9600.ENSPPYP00000015274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]