SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000015735 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000015735
Domain Number 1 Region: 297-502
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-69
Family Nuclear receptor ligand-binding domain 0.0000126
Further Details:      
 
Domain Number 2 Region: 25-115
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-29
Family Nuclear receptor 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000015735   Gene: ENSPPYG00000014064   Transcript: ENSPPYT00000016356
Sequence length 504
Comment pep:known chromosome:PPYG2:3:123344723:123371392:-1 gene:ENSPPYG00000014064 transcript:ENSPPYT00000016356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNI
QYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLIEMQSAM
KTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLQPKPQLEQENIKSSSPPSSDFAKEEVIG
MVTRAHKDTFMYNQEQRENSAESMQPQRGERIPKNMEQYNLNHDHCGNGLSSHFPCSESQ
QHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPIDGFSQNENKNSYMCN
TGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLSQHDQV
NLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFSEKLNA
LQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFTKLL
LKLPDLRSLNNMHSEELLAFKVHP
Download sequence
Identical sequences H2PBB8
XP_009237549.1.23681 ENSPPYP00000015735 ENSPPYP00000015735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]