SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016439 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016439
Domain Number 1 Region: 242-504
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-80
Family Protein kinases, catalytic subunit 0.0000000199
Further Details:      
 
Domain Number 2 Region: 99-229
Classification Level Classification E-value
Superfamily SH2 domain 7.68e-30
Family SH2 domain 0.0000254
Further Details:      
 
Domain Number 3 Region: 48-125
Classification Level Classification E-value
Superfamily SH3-domain 9.24e-17
Family SH3-domain 0.0000283
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000016439
Domain Number - Region: 2-30
Classification Level Classification E-value
Superfamily PH domain-like 0.000639
Family Pleckstrin-homology domain (PH domain) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016439   Gene: ENSPPYG00000014716   Transcript: ENSPPYT00000017108
Sequence length 515
Comment pep:novel chromosome:PPYG2:4:49639943:49676444:-1 gene:ENSPPYG00000014716 transcript:ENSPPYT00000017108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEE
EDNSEEIVVAMYDFQATEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTG
KKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSG
FRHYHIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTA
GFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKV
MMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEG
MEYLERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEV
FNYSRFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYE
VMLRCWQEKPEGRPSFEDLLRTIDELVECEETFGR
Download sequence
Identical sequences H2PD91
ENSPPYP00000016439 ENSPPYP00000016439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]