SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016712 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016712
Domain Number 1 Region: 42-253
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.7e-83
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000018
Further Details:      
 
Domain Number 2 Region: 543-761
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.5e-60
Family Ankyrin repeat 0.0000173
Further Details:      
 
Domain Number 3 Region: 249-381
Classification Level Classification E-value
Superfamily E set domains 3.27e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000112
Further Details:      
 
Domain Number 4 Region: 809-890
Classification Level Classification E-value
Superfamily DEATH domain 7.06e-16
Family DEATH domain, DD 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000016712
Domain Number - Region: 875-923
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.017
Family DNA polymerase beta, N-terminal domain-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016712   Gene: ENSPPYG00000014965   Transcript: ENSPPYT00000017391
Sequence length 969
Comment pep:novel chromosome:PPYG2:4:106976567:107068077:1 gene:ENSPPYG00000014965 transcript:ENSPPYT00000017391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRY
VCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNTHLHAHSLVGKHCE
DGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQ
AEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAI
YDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGD
FSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEV
QRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITF
HPGTTKSNAGMKHGTMDTESEKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATDGNG
EVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQ
DENGDSVLHLAIIHLHSQLVRDLLEVTAGLISDDIINMRNDLYQTPLHLAVITNQEDVVE
DLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHRKAALLLDHPNGDGLNAIHLAM
MSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDG
TTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMA
TSWQVFDILNGKPYEPEFISDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKL
GLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTS
QTHSLPLSPASTRQQIDELQDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYG
QEGPLEGKI
Download sequence
Identical sequences H2PE04
XP_009238496.1.23681 ENSPPYP00000016712 ENSPPYP00000016712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]