SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000016882 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000016882
Domain Number 1 Region: 5-291
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.32e-74
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 397-578
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.000000293
Further Details:      
 
Domain Number 3 Region: 264-368
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-17
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 730-785
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-16
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000016882   Gene: ENSPPYG00000015112   Transcript: ENSPPYT00000017563
Sequence length 786
Comment pep:known chromosome:PPYG2:4:153330779:153675077:1 gene:ENSPPYG00000015112 transcript:ENSPPYT00000017563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSVAQRKF
AHSLRDFKFEFIGDAVTDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFR
KEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEADIQVEQNRQHFYELSLE
YVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINIQNTRNRFE
GTRSEVEELMNKIRQNPKDHKRASQFTAEGYLYVQEKRPAPFGSNWVKHYCMYRKAAKKF
NMIPFEHRSGGKLGDGEVFFLKECTKRHTDSIDRRFCFDIEAADRPGVSLTMQAFSEEER
KQWLEALGGKEALSHSFNTAIIPRPEGNAQLDKMGFTIIRKCISAVETRGINDQGLYRVV
GVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSAMKQYLRSLPEPLMTYELHGDFI
VPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGP
TLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRTPPDTTFPEPTCLSASPPNAPPRQS
KRQGQRTKRPVAVYNLCLELEDGDNPYPSKEDTPTSSLDSLSSPSPVTTAVPGPPGPDKN
HLLADGGSFGDWASTIPGQTRSSVVQWLNPQSPTTTSSNTAVTPLSPGSSPFPFSPPATV
ADKPPESISSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQ
NYVKLL
Download sequence
Identical sequences H2PEG6
XP_002815242.1.23681 ENSPPYP00000016882 9600.ENSPPYP00000016882 ENSPPYP00000016882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]