SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017399 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017399
Domain Number 1 Region: 6-328
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.97e-75
Family Ankyrin repeat 0.0000151
Further Details:      
 
Domain Number 2 Region: 357-457
Classification Level Classification E-value
Superfamily DEATH domain 1.24e-18
Family DEATH domain, DD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017399   Gene: ENSPPYG00000015563   Transcript: ENSPPYT00000018104
Sequence length 467
Comment pep:known chromosome:PPYG2:5:75784485:75829707:1 gene:ENSPPYG00000015563 transcript:ENSPPYT00000018104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPQMNRTALHFAVGRNHLSAVDFLLKHKARVDVADKKHGLTVIHLAAWSGSLQVMLMLV
KAGADQRAKNQDGMNALHFAAQSNHVRIVEYLIQDLHLKDLNQPDEKGRKPFLLAAERGH
VEMIEKLTFLNLHTSEKDKEGNTALHLAAKHGHSPAVQVLLTQWQDINEMNENGETPFFL
SVEGGHEECSKVLLTAGSDINIPNKLSISSLQIATRNGHASLVNFLLSENVDLHQKVEPK
ESPLHLAVINNHITVVNSLLSAQHDIDILNQKQQTPLHVAADCGNVELVETLLKAGCDLK
AVDKQGKTALAVASRSNHSLVVDMLIKAERYYAWREEHHDSIRDPSTGFTLTFKQDHSLE
TRHIRTLLWDLAYHQLKANEWQRLARSWNFTDDQIRAIEEQWSGNESFREHGHRALLIWL
HGTLMTQADPAKQLYEKLVHAGFPKLAEKTRHFKSKTDLNSKKCVVS
Download sequence
Identical sequences H2PFW3
9600.ENSPPYP00000017399 ENSPPYP00000017399 ENSPPYP00000017399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]