SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000017595 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000017595
Domain Number 1 Region: 367-530
Classification Level Classification E-value
Superfamily SPOC domain-like 1.73e-28
Family SPOC domain 0.00085
Further Details:      
 
Domain Number 2 Region: 10-149
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.98e-16
Family Canonical RBD 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000017595   Gene: ENSPPYG00000015734   Transcript: ENSPPYT00000018305
Sequence length 533
Comment pep:known chromosome:PPYG2:5:128520319:128522052:-1 gene:ENSPPYG00000015734 transcript:ENSPPYT00000018305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPKDHHRTNQTLFLGNLDTTVTETDLRREFDHFGVITEIDIKSPSLGQTSNYGFLKFEN
LDMSHRAKLAMFSKIIIWNPIKIGYGKATHTTRLWVGGLKPWMPLAALALQKGDSWVYIQ
YESLDAVHAAWTHMRGFPLGGPDHHLRVDFADTKRCYQQQYMLPLPLTHYELVTDAFGHQ
ALDPLRGADRTPPLLYRDCDRDLYPDSDWMPPPPPVGEGSTGTAATAVPAYEPLNSLDHR
QHSWSLDRDRGDQDLPSSRDQPGKQKLPEESGGRHLNRSPESDCPRKCHCTPSPDHSPEK
SQGDKRDHENSASAEWIGSTTEGKNLLKKEDHTDGSAPSTNTVSWKLKSPSQKQDEGTAP
VAAASPKLCLAWQGMLLLKNSNFPSNIPTCSCCRVTSKWLAVFLWRAKVAQLRITQCLCL
DQPKLDEVTRCIKVAGPNGYAILLAVPGSSDSRSSSSSDTVISTKRLLRSLVSYLKQKQI
PRVISLGEHNKDKKNTGILLAFPPCELSQQFLDSKALAKSEDYLVMIIVHAKL
Download sequence
Identical sequences H2PGE8
ENSPPYP00000017595 9600.ENSPPYP00000017595 ENSPPYP00000017595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]