SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018514 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018514
Domain Number 1 Region: 21-135
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.21e-21
Family Synaptotagmin-like (S variant) 0.038
Further Details:      
 
Domain Number 2 Region: 256-436
Classification Level Classification E-value
Superfamily vWA-like 6.67e-18
Family Integrin A (or I) domain 0.018
Further Details:      
 
Domain Number 3 Region: 171-226
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000067
Family Synaptotagmin-like (S variant) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018514   Gene: ENSPPYG00000016553   Transcript: ENSPPYT00000019252
Sequence length 523
Comment pep:known chromosome:PPYG2:6:36776055:36883400:-1 gene:ENSPPYG00000016553 transcript:ENSPPYT00000019252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPEDMASLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQWR
EFGRTEVIDNTLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLG
EIVGSPGSRLEKPLTIGAFSLNSRTGKPMPAVSNGGVPGKKCGTIILSAEELSNCRTIKV
EVYDWDRDGSHDFIGEFTTSYRELARGQSQFNIYEVVNPKKKMKKKKYVNSGTVTLLSFA
VESECTFLDYIKGGTQINFTVAIDFTASNGNPSQSTSLHYMSPYQLNAYALALTAVGEII
QHYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYG
PTNFAPVVTHVARNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGV
GQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYVDRTGNHVLSMARLARDVLAEI
PDQLVSYMKAQGIRPRPPPAAPTHSPSQSPARTPPASPLHTHI
Download sequence
Identical sequences H2PIW0
ENSPPYP00000018514 ENSPPYP00000018514 9600.ENSPPYP00000018514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]