SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018740 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018740
Domain Number 1 Region: 130-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000143
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 2 Region: 15-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000235
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 56-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000225
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 168-199
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000752
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000018740
Domain Number - Region: 96-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000287
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 1-19
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0196
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018740   Gene: ENSPPYG00000016749   Transcript: ENSPPYT00000019482
Sequence length 199
Comment pep:known chromosome:PPYG2:6:65120850:65146671:-1 gene:ENSPPYG00000016749 transcript:ENSPPYT00000019482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPLYTGRFCHQRYNPCD
LLHNPCRNNSTCLALVDGNQHCICREEFEGKNCEIDVKECLFLSCQDYGDCEDMVNNFRP
GFSGSLCEIEINECSSEPCKNNGTCVDLTNRFFCNCEPGYHGPFCELDVNKCKISPCLDE
ENCVYRTDGYNCLCAPGYT
Download sequence
Identical sequences H2PJH7
ENSPPYP00000018740 9600.ENSPPYP00000018740 ENSPPYP00000018740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]