SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000018781 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000018781
Domain Number 1 Region: 127-318
Classification Level Classification E-value
Superfamily vWA-like 5.19e-61
Family Integrin A (or I) domain 0.0000674
Further Details:      
 
Domain Number 2 Region: 2270-2475
Classification Level Classification E-value
Superfamily vWA-like 3.26e-57
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 3 Region: 1159-1351
Classification Level Classification E-value
Superfamily vWA-like 1.17e-56
Family Integrin A (or I) domain 0.00012
Further Details:      
 
Domain Number 4 Region: 433-617
Classification Level Classification E-value
Superfamily vWA-like 1.35e-56
Family Integrin A (or I) domain 0.00017
Further Details:      
 
Domain Number 5 Region: 2492-2695
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.92e-33
Family Laminin G-like module 0.044
Further Details:      
 
Domain Number 6 Region: 1911-2077
Classification Level Classification E-value
Superfamily Fibronectin type III 3.39e-23
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 7 Region: 1727-1897
Classification Level Classification E-value
Superfamily Fibronectin type III 2.34e-22
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 8 Region: 634-803
Classification Level Classification E-value
Superfamily Fibronectin type III 8.51e-22
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 9 Region: 1541-1700
Classification Level Classification E-value
Superfamily Fibronectin type III 1.66e-21
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 10 Region: 1360-1536
Classification Level Classification E-value
Superfamily Fibronectin type III 4.12e-21
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 11 Region: 815-986
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-20
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 12 Region: 2090-2175
Classification Level Classification E-value
Superfamily Fibronectin type III 2.15e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 13 Region: 1002-1159
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-17
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 14 Region: 332-422
Classification Level Classification E-value
Superfamily Fibronectin type III 1.06e-17
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 15 Region: 2178-2263
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000124
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 16 Region: 26-108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000388
Family Fibronectin type III 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000018781   Gene: ENSPPYG00000016780   Transcript: ENSPPYT00000019523
Sequence length 3036
Comment pep:known chromosome:PPYG2:6:75678636:75797398:-1 gene:ENSPPYG00000016780 transcript:ENSPPYT00000019523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRLPPALAALGAALLLSSIEAEVDPPSDLNFKIIDENTVHMSWAKPVDPIVGYRITVD
PTTDGPTKEFTLAASTTETLLSELVPETEYVVTITSYDEVEESVPVIGQLTIQTGSSTKP
VEKKPGKTEIQKCSVSAWTDLVFLVDGSWSVGRNNFKYILDFIAALVSAFDIGEEKTRVG
VVQYSSDTRTEFNLNQYYQRDELLAAIKKIPYKGGNTMTGDAIDYLVKNTFTESAGARVG
FPKVAIIITDGKSQDEVEIPARELRNVGVEVFSLGIKAADAKELKQIASTPSLNHVFNVA
NFDAIVDIQNEIISQVCSGVDEQLGELVSGEEVVEPPSNLIAMEVSSKYVKLNWNPSPSP
VTGYKVILTPMTAGSRQHALSVGPQTTTLSVRDLSADTEYQISVSAMKGMTSSEPISIME
KTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLVKSFEISPNRVQIS
LVQYSRDPHTEFTLKKFTKVEDIIEAINTFPYRGGSTNTGKAMTYVREKIFVPSKGSRSN
VPKVMILITDGKSSDAFRDPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPAETHVFTVE
DFDAFQRISFELTQSICLRIEQELAAIKKKAYVPPKDLSFSEVTSYGFKTNWSPAGENVF
SYHITYKEATGDDEVTVVEPASSTSVVLSNLKPETLYLVNVTAEYEDGFSIPLAGEETTE
EVKGAPRNLKVTDETTDSFKITWTQAPGRVLRYRIIYRPVAGGESREVTTPPNQRRRTLE
NLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGK
VKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAGDALFGEGT
TLEERGSPQDLVTKDITDTSIGAYWTSAPGMVRGYRVSWKSLYDDVDTGEKNLPEDAIHT
MIENLQPETKYRISVFATYSSGEGEPLTGDATTELSRDSKTLKVDEETENTMRVTWKPAP
GKVVNYRVVYRPHGGGRQMIAKVPPTVTSTVLKRLQPQTTYDITVLPIYKTGEGKLRQGS
GTTASRFKSPRNLKTSDPTMSSFRVTWEPAPGEVKGYKVTFHPTGDDRRLGELVVGPYDN
TVVLEELRAGTTYKVNVFGMFDMECLTRAEADIVLLVDGSWSIGRANFRTVRSFISRIVE
VFDIGPKRVQVALAQYSGDPRTEWQLNAHRDKKSLLQAVANLPYKGGNTLTGMALNFIRQ
QNFRTQAGMRPRARKIGVLITDGKSQDDVEAPSKKLKDEGVELFAIGIKNADEVELKMIA
TDPDDTHAYNVADFESLSRIVDDLTINLCNSVKGPGDLEAPSNLVISERTHRSFRVSWTP
PSDSVDRYKVEYYPVSGGKRQEFYVSRMETSTVLKDLKPETEYVVNVYSVVEDEYSEPLK
GTEKTLPVPVVSLNIYDVGPTTMHVQWQPVGGATGYILSYKPVKDTEPTRPKEMRLGPTV
NDMQLTDLVPNTEYAVTVQAVLHDLTSEPVTVREVTLPLPRPQDLKLRDVTHSTMNVFWE
PVPGKVRKYIVRYKTPEEDVKEVEVDRSETSTSLKDLFSQTLYTVSVSAVHDEGESPPVT
AQETTRPVPAPTNLKITEVTSEGFRGTWDHGASDVSLYRITWAPFGSSDKMETILNGDEN
TLVFENLNPNTVYEVSITAIYPDESESDDLIGSERTLPILTTQAPKSGPRNLQVYNATSN
SLTVKWDPASGRVQKYRITYQPSTGEGNEQMTTIGGRQNSVVLQKLKPDTPYTITVSSLY
PDGEGGRMTGRGKTKPLNTVRNLRVYDPSTSTLSVRWDHAEGNPRQYKLFYAPAAGGPEE
LVPIPGNTNYAILRNLQPDTSYTVTVVPVYTEGDGGRTSDTGRTLMRGLARNVQVYNPTP
NSLDVRWDPAPGPVLQYRVVYSPVDGTRPSESIVVPGSTRMVHLERLIPDTLYSVNLVAL
YSDGEGNPSPAQGRTLPRSGPRNLRVFGETTNSLSVAWDHADGPVQQYRIIYSPTVGDPI
DEYTTVPGRRNNVILQPLQPDTPYKITVIAVYEDGDGGHLTGNGRTVGLLPPQNIHISDE
WYTRFRVSWDPSPSPVLGYKIVYKPVGSNEPMEAFVGEMTSYTLHNLNPSTTYDVNVYAQ
YDSGLSVPLTDRGTTLYLNVTDLKTYQIGWDTFCVKWSPHRAATSYRLKLSPADGTRGQE
ITVRGSETSHCFTGLSPDTDYGVTVFVQTPNLEGPGVSVKEHTTVKPTEAPTEPPTPPPP
PTIPPARDVCKGAKADIVFLTDASWSIGDDNFNKVVKFIFNTVGGFDEISPAGIQVSFVQ
YSDEVKSEFKLNTYNDKALALGALQNIRYRGGNTRTGKALTFIKEKVLTWESGMRKNVPK
VLVVVTDGRSQDEVKKAALVIQQSGFSVFVVGVADVDYNELANIASKPSERHVFIVDDFE
SFEKIEDNLITFVCETATSSCPLIYLDGYTSPGFKMLEAYNLTEKNFASVQGVSLESGSF
PSYSAYRIQKNAFVNQPTADLHPNGLPPSYTIILLFRLLPETPSDPFAIWQITDRDYKPQ
VGVIADPSSKTLSFFNKDTRGEVQTVTFDTEEVKTLFYGSFHKVHIVVTSKSVKIYIDCY
EIIEKDIKEAGNITTDGYEVLGKLLKGERKSAAFQIQSFDIVCSPVWTSRDRCCDIPSRR
DEAKCPAFPNSCTCTQDSVGPPGPPGPAGGPGAKGPRGERGISGAIGPPGPRGDIGPPGP
QGPPGPQGPNGLSIPGEQGRQGMKGDAGEPGLPGRTGTPGLPGPPGPMGPPGDRGFTGKD
GAMGPRGPPGPPGSPGSPGVTGPSGKPGKPGDHGRPGPSGLKGEKGDRGDIASQNMMRAV
ARQVCEQLISGQMNRFNQMLNQIPNDYQSSRNQPGPPGPPGPPGSAGARGEPGPGGRPGF
PGTPGMQGPPGERGLPGEKGERGTGSPGPRGLPGPPGPQGESRTGPPGSTGSRGPPGPPG
RPGNSGIRGPPGPPGYCDSSQCASIPYNGQGYPGSG
Download sequence
Identical sequences H2PJL6
9600.ENSPPYP00000018781 ENSPPYP00000018781 ENSPPYP00000018781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]