SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019028 from Pongo abelii 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019028
Domain Number 1 Region: 75-180
Classification Level Classification E-value
Superfamily WWE domain 1.02e-32
Family WWE domain 0.00000111
Further Details:      
 
Domain Number 2 Region: 35-80
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000683
Family RING finger domain, C3HC4 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019028   Gene: ENSPPYG00000016994   Transcript: ENSPPYT00000019779
Sequence length 355
Comment pep:known chromosome:PPYG2:6:129838558:129839891:1 gene:ENSPPYG00000016994 transcript:ENSPPYT00000019779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCGEIDHSINMLPTNRKANESCSNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCV
KGASWLGKRCALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRNGWWQYDERT
SRELEDAFSKGKKNTEMLIAGFLYVADLENMVQYRRNEHGRRRKIKRDIIDIPKKGVAGL
MLDCDANTNLARESSADGADSVSAQSGASVQPLVSSVRPLTSVDDGQLTSRAISPDASTS
LEDSFAHFQLSGDNTAERSHRGEGEEDHESPSSGRVPAPDTSIEETESDASSDSEDVSAV
VAQHSLTQQRLLVSNANQTVPDRSDRSGTDRSVAGGGTVSVRSRRPDGQCTVTEV
Download sequence
Identical sequences H2PKA3
ENSPPYP00000019028 ENSPPYP00000019028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]